GTF3C2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GTF3C2 antibody: synthetic peptide directed towards the middle region of human GTF3C2. Synthetic peptide located within the following region: YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	101 kDa
Gene Name	general transcription factor IIIC subunit 2
Database Link	NP_001512 Entrez Gene 2976 Human UniProt ID Q8WUA4
Background	GTF3C2 is required for RNA polymerase III-mediated transcription. GTF3C2 is a component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. GTF3C2 may play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1.
Synonyms	TFIIIC-BETA; TFIIIC110
Note	Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 92%; Pig: 85%; Rat: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.