FIZ1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FIZ1 antibody: synthetic peptide directed towards the middle region of human FIZ1. Synthetic peptide located within the following region: LAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	52 kDa
Gene Name	FLT3 interacting zinc finger 1
Database Link	NP_116225 Entrez Gene 84922 Human UniProt ID Q96SL8
Background	FIZ1 is zinc finger protein, which interacts with a receptor tyrosine kinase involved in the regulation of hematopoietic and lymphoid cells. FIZ1 also interacts with a transcription factor that regulates the expression of rod-specific genes in retina.
Synonyms	ZNF798
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Dog: 86%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.