Txlng Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Txlng antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KADMVCNSQANDILQHQDPSCGGTTKKHSLEGDEGSDFITKNRNLVSSVF
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	taxilin gamma
Database Link	NP_849266 Entrez Gene 55787 Human UniProt ID Q8BHN1
Background	4932441K18Rik may be involved in intracellular vesicle traffic.4932441K18Rik inhibits ATF4-mediated transcription, possibly by dimerizing with ATF4 to form inactive dimers that cannot bind DNA.4932441K18Rik may be involved in regulating bone mass density through an ATF4-dependent pathway. 4932441K18Rik may be involved in cell cycle progression.
Synonyms	4932441K18Rik; Fiat; Lrp; MGC116250
Note	Immunogen sequence homology: Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 93%; Rat: 92%; Human: 92%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.