Helt Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Helt antibody is: synthetic peptide directed towards the C-terminal region of Mouse Helt. Synthetic peptide located within the following region: LPEPDFSYQLHAASPEFPGHSPGEATMFPQGATPGSFPWPPGAARSPALP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	helt bHLH transcription factor
Database Link	NP_776150 Entrez Gene 234219 Mouse UniProt ID Q7TS99
Background	Helt is a transcriptional repressor which binds preferentially to the canonical E box sequence 5'-CACGCG-3' and is required for the development of GABAergic neurons.
Synonyms	HCM1228; HES-like; HESL; Heslike; Mgn
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%; Horse: 85%; Human: 85%; Bovine: 85%; Pig: 77%; Rabbit: 77%; Guinea pig: 77%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.