Zkscan17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Zkscan17 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: GKIFRWRVNFIRHLRSRREQKPHKCSVCGELFSDSEDLDGHLETHEAQKP
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	zinc finger with KRAB and SCAN domains 17
Database Link	NP_766529 Entrez Gene 268417 Mouse UniProt ID Q5SXI5
Background	Zkscan17 is a DNA-binding transcription factor that can both act as an activator and a repressor.
Synonyms	BC040205; D130067D09; Nizp1; RP23-210M6.6; Zfp496; Znf496
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Sheep: 93%; Bovine: 93%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.