Ebf4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EBF4 antibody: synthetic peptide directed towards the N terminal of human EBF4. Synthetic peptide located within the following region: YDRQGQPVEVERTAFIDFVEKDREPGTEKTNNGIHYRLRLVYNNGLRTEQ
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	early B cell factor 4
Database Link	Entrez Gene 228598 Mouse UniProt ID Q8K4J2
Background	EBF4 is a member of Olf-1/Ebf-like gene family. It is expressed in the neuronal and basal cell layers of olfactory epithelium and may interact with other O/E family members to regulate gene expression in the olfactory sensory neurons.
Synonyms	COE4; EBF-4; KIAA1442; O/E-4; OE-4; RP5-860F19.3
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 86%; Guinea pig: 86%; Zebrafish: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.