Ebf4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Ebf4 antibody: synthetic peptide directed towards the middle region of human Ebf4. Synthetic peptide located within the following region: ARSCGSASPRFAPSPGSQQSSYGSGLGAGLGSYGAPGVTGLGVPGSPSFL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	early B cell factor 4
Database Link	Entrez Gene 228598 Mouse UniProt ID Q8K4J2
Background	The function of this protein remains unknown.
Synonyms	COE4; EBF-4; KIAA1442; O/E-4; OE-4; RP5-860F19.3
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Rabbit: 100%; Dog: 93%; Human: 92%; Bovine: 92%; Guinea pig: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.