Dmrt2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	doublesex and mab-3 related transcription factor 2
Database Link	NP_665830 Entrez Gene 226049 Mouse UniProt ID Q8BG36
Background	DMRT2 is a protein disclosed by NIH MGC program
Synonyms	DSXL-2; DSXL2; OTTHUMP00000020964; OTTHUMP00000020966; OTTHUMP00000020967
Note	Immunogen sequence homology: Mouse: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Human: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.