GLYATL2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GLYATL2 antibody: synthetic peptide directed towards the middle region of human GLYATL2. Synthetic peptide located within the following region: LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	34 kDa
Gene Name	glycine-N-acyltransferase like 2
Database Link	NP_659453 Entrez Gene 219970 Human UniProt ID Q8WU03
Background	GLYATL2 belongs to the glycine N-acyltransferase family. GLYATL2 is a mitochondrial acyltransferase which transfers the acyl group to the N-terminus of glycine. It can conjugate a multitude of substrates to form a variety of N-acylglycines.
Synonyms	BXMAS2-10; GATF-B
Note	Immunogen sequence homology: Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.