Pex12 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Pex12 antibody is: synthetic peptide directed towards the C-terminal region of Rat Pex12. Synthetic peptide located within the following region: SVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMK
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	39 kDa
Gene Name	peroxisomal biogenesis factor 12
Database Link	NP_446373 Entrez Gene 116718 Rat UniProt ID O88177
Background	Pex12 is required for peroxisome biogenesis; functionally complements the mutation in fibroblasts from patients with Zellweger syndrome of complementation group III.
Synonyms	PAF-3; PAF3; Peroxin-12
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.