Rgs1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Rgs1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	23 kDa
Gene Name	regulator of G-protein signaling 1
Database Link	NP_056626 Entrez Gene 50778 Mouse UniProt ID Q9JL25
Background	Rgs1 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
Synonyms	1R20; BL34; IER1; IR20
Note	Immunogen sequence homology: Mouse: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%; Human: 86%; Pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.