IGSF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-IGSF1 antibody: synthetic peptide directed towards the middle region of human IGSF1. Synthetic peptide located within the following region: TMAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGGCGYGC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	immunoglobulin superfamily member 1
Database Link	NP_991402 Entrez Gene 3547 Human UniProt ID Q8N6C5
Background	This gene encodes a member of the immunoglobulin-like domain-containing superfamily. Proteins in this superfamily contain varying numbers of immunoglobulin-like domains and are thought to participate in the regulation of interactions between cells. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2010]
Synonyms	CHTE; IGCD1; IGDC1; INHBP; p120; PGSF2
Note	Immunogen sequence homology: Human: 100%; Pig: 86%; Mouse: 86%; Sheep: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Rat: 79%; Horse: 79%; Bovine: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.