YIPF6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-YIPF6 antibody: synthetic peptide directed towards the C terminal of human YIPF6. Synthetic peptide located within the following region: MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	Yip1 domain family member 6
Database Link	NP_776195 Entrez Gene 286451 Human UniProt ID Q96EC8
Background	YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family.The exact function of YIPF6 remains unknown.
Synonyms	FinGER6
Note	Immunogen sequence homology: Human: 100%; Rabbit: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.