Viperin (RSAD2) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-RSAD2 antibody: synthetic peptide directed towards the C terminal of human RSAD2. Synthetic peptide located within the following region: YLILDEYMRFLNCRKGRKDPSKSILDVGVEEAIKFSGFDEKMFLKRGGKY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	radical S-adenosyl methionine domain containing 2
Database Link	NP_542388 Entrez Gene 91543 Human UniProt ID Q8WXG1
Background	RSAD2 is a potential antiviral effector. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Synonyms	2510004L01Rik; cig5; cig33; vig1
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Horse: 93%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.