NIBAN1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FAM129A antibody: synthetic peptide directed towards the N terminal of human FAM129A. Synthetic peptide located within the following region: SYENKEAYQRGAAPKCRILPAGGKVLTSEDEYNLLSDRHFPDPLASSEKE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	103 kDa
Gene Name	family with sequence similarity 129 member A
Database Link	NP_443198 Entrez Gene 116496 Human UniProt ID Q9BZQ8
Background	FAM129A is expressed in subsets of thyroid tumors and Hashimoto's thyroiditis and it is a novel tumor marker.
Synonyms	C1orf24; GIG39; NIBAN
Note	Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.