SYDE1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SYDE1 antibody: synthetic peptide directed towards the N terminal of human SYDE1. Synthetic peptide located within the following region: PSPPEPEPQAPEGSQAGAEGPSSPEASRSPARGAYLQSLEPSSRRWVLGG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	synapse defective Rho GTPase homolog 1
Database Link	NP_149014 Entrez Gene 85360 Human UniProt ID Q6ZW31
Background	SYDE1 contains 1 Rho-GAP domain. It is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.
Synonyms	7h3; SYD1
Note	Immunogen sequence homology: Human: 100%; Bovine: 92%; Pig: 86%; Guinea pig: 86%; Rabbit: 85%; Dog: 79%; Rat: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.