DNASE2B Rabbit Polyclonal Antibody
CAT#: TA329458
Rabbit Polyclonal anti-DNASE2B antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-DNASE2B antibody: synthetic peptide directed towards the N terminal of human DNASE2B. Synthetic peptide located within the following region: EGKAVDWFTFYKLPKRQNKESGETGLEYLYLDSTTRSWRKSEQLMNDTKS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 39 kDa |
Gene Name | deoxyribonuclease II beta |
Database Link | |
Background | DNASE2B shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this protein is restricted to the salivary gland and lungs. The protein encoded by this gene shares considerable sequence similarity to, and is structurally related to DNase II. The latter is a well characterized endonuclease that catalyzes DNA hydrolysis in the absence of divalent cations at acidic pH. Unlike DNase II which is ubiquitously expressed, expression of this gene product is restricted to the salivary gland and lungs. The gene has been localized to chromosome 1p22.3 adjacent (and in opposite orientation) to the uricase pseudogene. Two transcript variants encoding different isoforms have been described for this gene. |
Synonyms | DLAD |
Note | Immunogen sequence homology: Human: 100%; Rat: 86%; Horse: 86%; Rabbit: 86%; Dog: 82%; Pig: 79%; Bovine: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Transmembrane |
Protein Pathways | Lysosome |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它DNASE2B产品