JMJD6 Rabbit Polyclonal Antibody

CAT#: TA329407

Rabbit Polyclonal anti-PTDSR antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4,628.00


货期*
2周

规格
    • 50 ug

Product images

经常一起买 (4)
Transient overexpression lysate of jumonji domain containing 6 (JMJD6), transcript variant 2
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00


Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 20 µg
    • 20 ug

CNY 2,900.00
CNY 6,650.00


Recombinant protein of human jumonji domain containing 6 (JMJD6), transcript variant 2, 100 µg
    • 100 ug

CNY 9,998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PTDSR antibody: synthetic peptide directed towards the middle region of human PTDSR. Synthetic peptide located within the following region: PRELIKVTRDEGGNQQDEAITWFNVIYPRTQLPTWPPEFKPLEILQKPGE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 43 kDa
Gene Name arginine demethylase and lysine hydroxylase
Background PTDSR is required during embryogenesis and differentiation of multiple organs during embryogenesis. PTDSR probably acts as a key regulator of hematopoietic differentiation. PTDSR may not be required for apoptotic cell clearance by macrophages but seems to be necessary for the regulation of macrophage cytokine responses
Synonyms PSR; PTDSR; PTDSR1
Note Immunogen sequence homology: Human: 100%; Zebrafish: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...