HIC2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IF, WB
Recommend Dilution	WB, IF
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	66 kDa
Gene Name	hypermethylated in cancer 2
Database Link	NP_055909 Entrez Gene 23119 Human UniProt ID Q96JB3
Background	HIC2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor.
Synonyms	HRG22; ZBTB30; ZNF907
Note	Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 77%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.