FOXF1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FOXF1 antibody: synthetic peptide directed towards the N terminal of human FOXF1. Synthetic peptide located within the following region: MDPASSGPSKAKKTNAGIRRPEKPPYSYIALIVMAIQSSPTKRLTLSEIY
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	38 kDa
Gene Name	forkhead box F1
Database Link	NP_001442 Entrez Gene 2294 Human UniProt ID Q12946
Background	FOXF1 belongs to the forkhead family of transcription factors which is characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in the regulation of pulmonary genes as well as embryonic development.
Synonyms	ACDMPV; FKHL5; FREAC1
Note	Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 92%
Reference Data
Protein Families	Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.