EMX2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-EMX2 antibody is: synthetic peptide directed towards the N-terminal region of Human EMX2. Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	28 kDa
Gene Name	empty spiracles homeobox 2
Database Link	NP_004089 Entrez Gene 2018 Human UniProt ID Q04743
Background	The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.
Synonyms	empty spiracles homeobox 2; empty spiracles homolog 2; OTTHUMP00000020578
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.