SLC26A3 Rabbit Polyclonal Antibody
CAT#: TA329353
Rabbit Polyclonal anti-SLC26A3 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-SLC26A3 antibody: synthetic peptide directed towards the middle region of human SLC26A3. Synthetic peptide located within the following region: DAVLHILMKKDYSTSKFNPSQEKDGKIDFTINTNGGLRNRVYEVPVETKF |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 84 kDa |
Gene Name | solute carrier family 26 member 3 |
Database Link | |
Background | SLC26A3 is a transmembrane glycoprotein that transports chloride ions across the cell membrane in exchange for bicarbonate ions. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. The protein is essential for intestinal chloride absorption, and mutations in this gene have been associated with congenital chloride diarrhea.The protein encoded by this gene is a transmembrane glycoprotein that functions as a sulfate transporter. It is localized to the mucosa of the lower intestinal tract, particularly to the apical membrane of columnar epithelium and some goblet cells. Mutations in this gene have been associated with congenital chloride diarrhea. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | CLD; DRA |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Rat: 93%; Mouse: 93%; Rabbit: 86%; Dog: 79%; Guinea pig: 79% |
Reference Data | |
Protein Families | Druggable Genome, Transcription Factors, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它SLC26A3产品