SLC34A3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3. Synthetic peptide located within the following region: GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	63 kDa
Gene Name	solute carrier family 34 member 3
Database Link	NP_543153 Entrez Gene 142680 Human UniProt ID Q8N130
Background	SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney (Segawa et al., 2002 [PubMed 11880379]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-942 AK095999.1 1-942 943-2142 AB055000.1 827-2026
Synonyms	HHRH; NPTIIc
Note	Immunogen sequence homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.