CDX4 Rabbit Polyclonal Antibody

CAT#: TA329303

Rabbit Polyclonal anti-CDX4 antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5,250.00


货期*
6周

规格
    • 100 ul

Product images

经常一起买 (2)
Transient overexpression lysate of caudal type homeobox 4 (CDX4)
    • 100 ug

CNY 3,080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1,430.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CDX4 antibody: synthetic peptide directed towards the middle region of human CDX4. Synthetic peptide located within the following region: TDHQRLELEKEFHCNRYITIQRKSELAVNLGLSERQVKIWFQNRRAKERK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 30 kDa
Gene Name caudal type homeobox 4
Background CDX are homeodomain transcription factors related to the Drosophila caudal gene. The vertebrate CDX have been implicated in the development of the posterior embryo. Several signaling molecules, notably retinoic acid (RA) and members of the Wnt (wingless) and fibroblast growth factor (FGF) families, are also implicated in patterning of the posterior vertebrate embryo. CDX family is the target of Wnt, RA and FGF signaling, suggesting that CDX factors act to convey the activity of these signaling molecules to Hox genes.
Synonyms caudal type homeobox 4; caudal type homeo box transcription factor 4; caudal type homeobox transcription factor 4; OTTHUMP00000023566
Note Immunogen sequence homology: Dog: 100%; Human: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93%; Guinea pig: 92%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transcription Factors
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...