Hoxb1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Hoxb1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ETQVKIWFQNRRMKQKKREREGGRMPAGPPGCPKEAAGDASDQSACTSPE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	homeobox B1
Database Link	NP_032292 Entrez Gene 15407 Mouse UniProt ID P17919
Background	Hoxb1 is a sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. It acts on the anterior body structures.
Synonyms	Hox-2.9; Hox-2I; HOX2; HOX2I; MGC116843; MGC116844; MGC116845
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 90%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.