Hlf Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Hlf antibody is: synthetic peptide directed towards the N-terminal region of Mouse Hlf. Synthetic peptide located within the following region: MEKMSRQLPLNPTFIPPPYGVLRSLLENPLKLPLHPEDAFSKEKDKGKKL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	33 kDa
Gene Name	hepatic leukemia factor
Database Link	NP_766151 Entrez Gene 217082 Mouse UniProt ID Q8BW74
Background	The function of this protein remains unknown.
Synonyms	MGC33822
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 93%; Sheep: 93%; Bovine: 93%; Guinea pig: 93%; Horse: 92%; Mouse: 86%; Rabbit: 83%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.