Nfe2l1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Nfe2l1 antibody is: synthetic peptide directed towards the C-terminal region of MOUSE Nfe2l1. Synthetic peptide located within the following region: EVFGRLRDEHGRPYSPSQYALQYAGDGSVLLIPRTMADQQARRQERKPKD
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	49 kDa
Gene Name	nuclear factor, erythroid derived 2,-like 1
Database Link	NP_032712 Entrez Gene 18023 Mouse UniProt ID Q61985
Background	This gene encodes a protein that is involved in globin gene expression in erythrocytes. Confusion has occurred in bibliographic databases from the use of NRF1 for this gene, NFE2L1, and for 'nuclear respiratory factor 1' which has an official symbol of NRF1.
Synonyms	FLJ00380; HBZ17; LCR-F1; NRF1; TCF11
Note	Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.