c-Myb (MYB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-MYB antibody is: synthetic peptide directed towards the C-terminal region of Human MYB. Synthetic peptide located within the following region: VPKNRSLASPLQPCSSTWEPASCGKMEEQMTSSSQARKYVNAFSARTLVM
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	70 kDa
Gene Name	MYB proto-oncogene, transcription factor
Database Link	NP_005366 Entrez Gene 4602 Human UniProt ID P10242
Background	This gene encodes a transcription factor that is a member of the MYB family of transcription factor genes. The protein contains three domains, an N-terminal DNA-binding domain, a central transcriptional activation domain and a C-terminal domain involved in transcriptional repression. This protein plays an essential role in the regulation of hematopoiesis and may play a role in tumorigenesis. Alternative splicing results in multiple transcript variants.
Synonyms	c-myb; c-myb_CDS; Cmyb; efg
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Dog: 80%
Reference Data
Protein Families	Druggable Genome, ES Cell Differentiation/IPS, Stem cell - Pluripotency, Transcription Factors

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.