LEC (CCL16) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CCL16 antibody: synthetic peptide directed towards the N terminal of human CCL16. Synthetic peptide located within the following region: SLLVLILIITSASRSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKAL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	11 kDa
Gene Name	C-C motif chemokine ligand 16
Database Link	NP_004581 Entrez Gene 6360 Human UniProt ID O15467
Background	CCL16 gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. CCL16 displays chemotactic activity for lymphocytes and monocytes but not for neutrophils. This cytokine also shows a potent myelosuppressive activity and suppresses proliferation of myeloid progenitor cells. The expression of this gene is upregulated by IL-10.
Synonyms	CKb12; HCC-4; ILINCK; LCC-1; LEC; LMC; Mtn-1; NCC-4; NCC4; SCYA16; SCYL4
Note	Immunogen sequence homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.