HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
CAT#: TA329159
Rabbit Polyclonal anti-HIF1A antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 83 kDa |
Gene Name | hypoxia inducible factor 1 alpha subunit |
Database Link | |
Background | Hypoxia-inducible factor-1 (HIF1) is a transcription factor found in mammalian cells cultured under reduced oxygen tension that plays an essential role in cellular and systemic homeostatic responses to hypoxia. HIF1 is a heterodimer composed of an alpha subunit and a beta subunit. The beta subunit has been identified as the aryl hydrocarbon receptor nuclear translocator (ARNT). HIF1A is the alpha subunit of HIF-1. Overexpression of a natural antisense transcript (aHIF) of this gene has been shown to be associated with nonpapillary renal carcinomas. Two alternative transcripts encoding different isoforms have been identified. |
Synonyms | bHLHe78; HIF-1-alpha; HIF-1A; HIF-1alpha; HIF1; HIF1-ALPHA; MOP1; PASD8 |
Note | Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Yeast: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 87%; Zebrafish: 86% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | mTOR signaling pathway, Pathways in cancer, Renal cell carcinoma |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它HIF-1 alpha产品