Bcl2l2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Bcl2l2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Bcl2l2. Synthetic peptide located within the following region: VQDWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVR
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	21 kDa
Gene Name	BCL2-like 2
Database Link	NP_031563 Entrez Gene 12050 Mouse UniProt ID P70345
Background	Bcl2l2 promotes cell survival. It blocks dexamethasone-induced apoptosis and mediates survival of postmitotic Sertoli cells by suppressing death-promoting activity of BAX.
Synonyms	BCL-W; Bcl2-L-2; BCLW; KIAA0271
Note	Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Rabbit: 93%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.