Tsc22d4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Tsc22d4 antibody is: synthetic peptide directed towards the N-terminal region of Rat Tsc22d4. Synthetic peptide located within the following region: PAPPAPAGPPPRLPNGEPNPDPGGRGTPRNGSPPPGAPASRFRVVKLPQG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	TSC22 domain family, member 4
Database Link	NP_001037749 Entrez Gene 684980 Rat UniProt ID Q3B8N7
Background	Tsc22d4 is a transcriptional repressor.
Synonyms	THG-1; THG1; TILZ2; TSC-22-like
Note	Immunogen sequence homology: Rat: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Pig: 87%; Guinea pig: 87%; Mouse: 86%; Bovine: 86%; Horse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.