MIXL1 Rabbit Polyclonal Antibody
CAT#: TA329102
Rabbit Polyclonal anti-MIXL1 antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MIXL1 antibody: synthetic peptide directed towards the N terminal of human MIXL1. Synthetic peptide located within the following region: MATAESRALQFAEGAAFPAYRAPHAGGALLPPPSPAAALLPAPPAGPGPA |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 25 kDa |
Gene Name | Mix paired-like homeobox |
Database Link | |
Background | MIXL1 is a novel human Mix-like homeobox gene. In normal hematopoiesis, its expression appears to be restricted to immature B- and T-lymphoid cells. |
Synonyms | MILD1; MIX; MIXL |
Note | Immunogen sequence homology: Human: 100% |
Reference Data | |
Protein Families | ES Cell Differentiation/IPS |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |