Kcnma1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivity	Mouse, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	GST fusion protein with the sequence SHSSHSSQ SSSKKSSSVHSIPSTANRPNRPKSRESRDKQNATRMTRMG QAEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIP PIREVEDEC, corresponding to residues 1097-1196 of mouse KCa1.1 variant 2 . Intracellular, C-terminus.
Formulation	Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: Phosphate buffered saline (PBS) pH 7.4, 1% BSA, 0.025% NaN3.
Reconstitution Method	Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification	The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST, and then the antibody was affinity purified on immobilized KCa1.1-GST.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Gene Name	potassium large conductance calcium-activated channel, subfamily M, alpha member 1
Database Link	NP_034740 Entrez Gene 83731 RatEntrez Gene 16531 Mouse UniProt ID Q08460
Background	The KCa1.1 channel (also known as BKCa, Maxi K+ or slo) is part of a structurally diverse group of K+ channels that are activated by an increase in intracellular Ca2+. KCa1.1 shows a large single channel conductance when recorded electrophysiologically and hence its name. It differs from the rest of the subfamily members in that it can be activated by both an increase in intracellular Ca2+ and by membrane depolarization. In addition, the KCa1.1 channel structurally differs from the other Ca2+-dependent K+ channels. While the latter group has a topology that resembles that of the voltage-dependent K+ channels, the KCa1.1 channel has an extracellular N-terminus domain as well as an additional transmembrane domain.KCa1.1 is expressed in virtually all cell types where it causes hyperpolarization and helps to connect between intracellular Ca2+ signaling pathways and membrane excitability.Indeed, KCa1.1 channels play a crucial role in smooth muscle contractility, neuronal spike shaping and neurotransmitter release.
Synonyms	bA205K10.1; BKTM; DKFZp686K1437; hSlo; K(VCA)alpha; KCa1.1; KCNMA; MaxiK; MGC71881; mSLO1; SAKCA; SLO; SLO-ALPHA; Slo1
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.