Abcc9 (Isoform SUR2A) Mouse Monoclonal Antibody [Clone ID: N319A/14]

Specifications

Product Data
Clone Name	N319A/14
Applications	IF, IHC, WB
Recommend Dilution	Immunoblot (IB) Immunohistochemistry (IHC) Immunocytochemistry (ICC)
Reactivity	Mouse, Rat
Host	Mouse
Clonality	Monoclonal
Immunogen	Fusion protein amino acids 1505-1546 (SSIVDAGLVLVFSEGILVECDTGPNLLQHKNGLFSTLVMTNK, cytoplasmic C-terminus) of mouse SUR2A (also known as Sulfonylurea receptor 2A, ATP-binding cassette transporter sub-family C member 9A and Abcc9A, accession number P70170). Rat: 97% identity (41/42 amino acids identical). Human: 92% identity (39/42 amino acids identical). 100% identity with SUR2C. <50% identity with SUR2B.
Specificity	Does not cross-react with SUR2B
Formulation	State: Purified
Conjugation	Unconjugated
Gene Name	ATP-binding cassette, sub-family C (CFTR/MRP), member 9
Database Link	Entrez Gene 20928 Mouse UniProt ID P70170
Synonyms	Sulfonylurea receptor 2
Note	USERS will cite the UC Davis/NIH NeuroMab Facility in any publication(s) describing the research utilizing the MATERIALS. The suggested acknowledgment statement is as follows: "The monoclonal antibody _ was developed by and/or obtained from the UC Davis/NIH NeuroMab Facility, supported by NIH grant U24NS050606 and maintained by the Department of Neurobiology, Physiology and Behavior, College of Biological Sciences, University of California, Davis, CA 95616." Also, please include the complete clone number (e.g., N52A/42) and the Antibody Registry identification number (e.g., RRID:AB_2120479) to avoid ambiguity. View Research License Agreement
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.