Mmab (NM_029956) Mouse Recombinant Protein
CAT#: TP502904
Purified recombinant protein of Mouse methylmalonic aciduria (cobalamin deficiency) cblB type homolog (human) (Mmab), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 7,106.00
Product images
![](https://cdn.origene.com/img/defaults-img.jpg)
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Mouse |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>MR202904 protein sequence
Red=Cloning site Green=Tags(s) MAVWLFGGRLGLRGRLSACRLLCPRFQSRGPQGGEDGDRLQPSSTAAKIPKIYTKTGDKGFSSTFTGERR PKDDQVFEAVGTTDELSSAIGFAMELVTEKGHMFAEELQKIQCMLQDVGSALATPRSSAREAHLKHTAFQ EGPVLELERWIDKYSSQLPPLKAFILPSGGKSSSALHFCRAVCRRAERRVVPLVQMGETDANVAKFLNRL SDYLFTVARYAAMKEGSQEKIYKKHDV myc-FLAG tag |
Tag | C-MYC/DDK |
Predicted MW | 26.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_084232 |
Locus ID | 77697 |
UniProt ID | Q9D273 |
Refseq Size | 3021 |
Cytogenetics | 5 F |
Refseq ORF | 714 |
Synonyms | 9130222L19Rik; ATR |
Summary | Adenosyltransferase involved in intracellular vitamin B12 metabolism. Generates adenosylcobalamin (AdoCbl) and directly delivers the cofactor to MUT in a transfer taht is stimulated by ATP-binding to MMAB and gated by MMAA.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |