MUSTN1 (NM_205853) Human Recombinant Protein
CAT#: TP314142
Recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), 20 µg
View other "MUSTN1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC214142 protein sequence
Red=Cloning site Green=Tags(s) MSQAGAQEAPIKKKRPPVKEEDLKGARGNLTKNQEIKSKTYQVMRECEQAGSAAPSVFSRTRTGTETVFE KPKAGPTKSVFG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 8.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_995325 |
Locus ID | 389125 |
UniProt ID | Q8IVN3 |
Refseq Size | 742 |
Cytogenetics | 3p21.1 |
Refseq ORF | 246 |
Synonyms | MUSTANG |
Summary | May be involved in the development and regeneration of the musculoskeletal system.[UniProtKB/Swiss-Prot Function] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404202 | MUSTN1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404202 | Transient overexpression lysate of musculoskeletal, embryonic nuclear protein 1 (MUSTN1) |
CNY 3,080.00 |
|
PH314142 | MUSTN1 MS Standard C13 and N15-labeled recombinant protein (NP_995325) |
CNY 19,520.00 |
|
TP710365 | Purified recombinant protein of human musculoskeletal, embryonic nuclear protein 1 (MUSTN1), full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |