beta Defensin 1 (DEFB1) (NM_005218) Human Recombinant Protein
CAT#: TP308244
Recombinant protein of human defensin, beta 1 (DEFB1), 20 µg
View other "beta Defensin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC208244 protein sequence
Red=Cloning site Green=Tags(s) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005209 |
Locus ID | 1672 |
UniProt ID | P60022 |
Refseq Size | 484 |
Cytogenetics | 8p23.1 |
Refseq ORF | 204 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Summary | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401597 | DEFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401597 | Transient overexpression lysate of defensin, beta 1 (DEFB1) |
CNY 3,080.00 |
|
PH308244 | DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209) |
CNY 14,250.00 |
|
TP720106 | Recombinant protein of human defensin, beta 1 (DEFB1) |
CNY 4,550.00 |
其它beta Defensin 1产品