beta Defensin 1 (DEFB1) (NM_005218) Human Mass Spec Standard
CAT#: PH308244
DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209)
View other "beta Defensin 1" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DEFB1 MS Standard C13 and N15-labeled recombinant protein (NP_005209) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC208244 |
Predicted MW | 7.4 kDa |
Protein Sequence |
>RC208244 protein sequence
Red=Cloning site Green=Tags(s) MRTSYLLLFTLCLLLSEMASGGNFLTGLGHRSDHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_005209 |
RefSeq Size | 484 |
RefSeq ORF | 204 |
Synonyms | BD1; DEFB-1; DEFB101; HBD1 |
Locus ID | 1672 |
Cytogenetics | 8p23.1 |
Summary | Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 1, an antimicrobial peptide implicated in the resistance of epithelial surfaces to microbial colonization. This gene maps in close proximity to defensin family member, defensin, alpha 1 and has been implicated in the pathogenesis of cystic fibrosis. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401597 | DEFB1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401597 | Transient overexpression lysate of defensin, beta 1 (DEFB1) |
CNY 3,080.00 |
|
TP308244 | Recombinant protein of human defensin, beta 1 (DEFB1), 20 µg |
CNY 2,900.00 |
|
TP720106 | Recombinant protein of human defensin, beta 1 (DEFB1) |
CNY 3,140.00 |
其它beta Defensin 1产品