PSME3 (NM_001267045) Human Tagged ORF Clone

CAT#: RG232329

  • TrueORF®

PSME3 (tGFP-tagged) - Homo sapiens proteasome (prosome, macropain) activator subunit 3 (PA28 gamma; Ki) (PSME3), transcript variant 3

ORF Plasmid: DDK tGFP



  "NM_001267045" in other vectors (2)

Need custom modification / cloning service?
Get a free quote

CNY 4,370.00


货期*
3周

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


PSME3 Rabbit polyclonal Antibody
    • 100 ul

CNY 1,999.00
CNY 3,280.00

热销推荐

Specifications

Product Data
Type Human Tagged ORF Clone
Tag TurboGFP
Synonyms HEL-S-283; Ki; PA28-gamma; PA28G; PA28gamma; REG-GAMMA
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RG232329 representing NM_001267045
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAAAAATGGATCCTCAAAAAAATAAAGTATTTGCAGTCTGGGGGCCTCTCAGCTTCTTATTACAGTT
ACAAGGTTGATTCTTTCAGGGAGCGGATCACAAGTGAGGCAGAAGACTTGGTGGCAAATTTTTTCCCAAA
GAAGTTATTAGAACTTGATAGTTTTCTGAAGGAACCAATCTTAAACATCCATGACCTAACTCAGATCCAC
TCTGACATGAATCTCCCAGTCCCTGACCCCATTCTTCTCACCAATAGCCATGATGGACTGGATGGTCCCA
CTTATAAGAAGCGAAGGTTGGATGAGTGTGAAGAAGCCTTCCAAGGAACCAAGGTGTTTGTGATGCCCAA
TGGGATGCTGAAAAGCAACCAGCAGCTGGTGGACATTATTGAGAAAGTGAAACCTGAGATCCGGCTGTTG
ATTGAGAAATGTAACACGGTCAAAATGTGGGTACAGCTCCTGATTCCCAGGATAGAAGATGGAAACAACT
TTGGGGTGTCCATTCAGGAGGAAACAGTTGCAGAGCTAAGAACTGTTGAGAGTGAAGCTGCATCTTATCT
GGACCAGATTTCTAGATATTATATTACAAGAGCCAAATTGGTTTCTAAAATAGCTAAATATCCCCATGTG
GAGGACTATCGCCGCACCGTGACAGAGATTGATGAGAAAGAATATATCAGCCTTCGGCTCATCATATCAG
AGCTGAGGAATCAATATGTCACTCTACATGACATGATCCTGAAAAATATCGAGAAGATCAAACGGCCCCG
GAGCAGCAATGCAGAGACTCTGTAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>RG232329 representing NM_001267045
Red=Cloning site Green=Tags(s)

MEKWILKKIKYLQSGGLSASYYSYKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIH
SDMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIEKVKPEIRLL
IEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHV
EDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001267045
ORF Size 795 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001267045.2
RefSeq Size 3782 bp
RefSeq ORF 798 bp
Locus ID 10197
Protein Families Stem cell - Pluripotency
Protein Pathways Antigen processing and presentation, Proteasome
Gene Summary The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator. The 20S core is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. The 19S regulator is composed of a base, which contains 6 ATPase subunits and 2 non-ATPase subunits, and a lid, which contains up to 10 non-ATPase subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. The immunoproteasome contains an alternate regulator, referred to as the 11S regulator or PA28, that replaces the 19S regulator. Three subunits (alpha, beta and gamma) of the 11S regulator have been identified. This gene encodes the gamma subunit of the 11S regulator. Six gamma subunits combine to form a homohexameric ring. Alternate splicing results in multiple transcript variants. [provided by RefSeq, May 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...