Cyclophilin A (PPIA) (NM_021130) Human Tagged ORF Clone
CAT#: RC203307
PPIA (Myc-DDK-tagged)-Human peptidylprolyl isomerase A (cyclophilin A) (PPIA)
ORF Plasmid: tGFP
"NM_021130" in other vectors (6)
Need custom modification / cloning service?
Get a free quote
CNY 1,800.00
CNY 3,705.00
Cited in 3 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | CYPA; CYPH; HEL-S-69p |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC203307 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTCAACCCCACCGTGTTCTTCGACATTGCCGTCGACGGCGAGCCCTTGGGCCGCGTCTCCTTTGAGC TGTTTGCAGACAAGGTCCCAAAGACAGCAGAAAATTTTCGTGCTCTGAGCACTGGAGAGAAAGGATTTGG TTATAAGGGTTCCTGCTTTCACAGAATTATTCCAGGGTTTATGTGTCAGGGTGGTGACTTCACACGCCAT AATGGCACTGGTGGCAAGTCCATCTATGGGGAGAAATTTGAAGATGAGAACTTCACCCTAAAGCATACGG GTCCTGGCATCTTGTCCATGGCAAATGCTGGACCCAACACAAATGGTTCCCAGTTTTTCATCTGCACTGC CAAGACTGAGTGGTTGGATGGCAAGCATGTGGTGTTTGGCAAAGTGAAAGAAGGCATGAATATTGTGGAG GCCATGGAGCGCTTTGGGTCCAGGAATGGCAAGACCAGCAAGAAGATCACCATTGCTGACTGTGGACAAC TCGAA ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC203307 protein sequence
Red=Cloning site Green=Tags(s) MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRH NGTGGKSIYGEKFEDENFTLKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVE AMERFGSRNGKTSKKITIADCGQLE myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_021130 |
ORF Size | 495 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_021130.5 |
RefSeq Size | 2288 bp |
RefSeq ORF | 498 bp |
Locus ID | 5478 |
UniProt ID | P62937 |
Domains | pro_isomerase |
MW | 18 kDa |
Gene Summary | This gene encodes a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. The encoded protein is a cyclosporin binding-protein and may play a role in cyclosporin A-mediated immunosuppression. The protein can also interact with several HIV proteins, including p55 gag, Vpr, and capsid protein, and has been shown to be necessary for the formation of infectious HIV virions. Multiple pseudogenes that map to different chromosomes have been reported. [provided by RefSeq, Jul 2008] |
Citations (3)
The use of this cDNA Clones has been cited in the following citations: |
---|
Effect of internal cleavage site mutations in human immunodeficiency virus type 1 capsid protein on its structure and function
,Tóth F; Kádas J; Mótyán JA; Tőzsér J,
FEBS Open Bio
,PubMed ID 27516963
[Cyclophilin A]
|
Proline isomerisation as a novel regulatory mechanism for p38MAPK activation and functions
,Brichkina, A;Nguyen, NT;Baskar, R;Wee, S;Gunaratne, J;Robinson, RC;Bulavin, DV;,
Cell Death Differ.
,PubMed ID 27233083
[Cyclophilin A]
|
Cyclophilin B enhances HIV-1 infection
,DeBoer, J;Madson, CJ;Belshan, M;,
Virology
,PubMed ID 26774171
[Cyclophilin A]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC203307L1 | Lenti ORF clone of Human peptidylprolyl isomerase A (cyclophilin A) (PPIA), Myc-DDK-tagged |
CNY 4,200.00 |
|
RC203307L2 | Lenti ORF clone of Human peptidylprolyl isomerase A (cyclophilin A) (PPIA), mGFP tagged |
CNY 4,200.00 |
|
RC203307L3 | Lenti ORF clone of Human peptidylprolyl isomerase A (cyclophilin A) (PPIA), Myc-DDK-tagged |
CNY 5,890.00 |
|
RC203307L4 | Lenti ORF clone of Human peptidylprolyl isomerase A (cyclophilin A) (PPIA), mGFP tagged |
CNY 4,200.00 |
|
RG203307 | PPIA (tGFP-tagged) - Human peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
CNY 3,400.00 |
|
SC111937 | PPIA (untagged)-Human peptidylprolyl isomerase A (cyclophilin A) (PPIA) |
CNY 1,800.00 |
其它Cyclophilin A产品