Mapk1 (NM_011949) Mouse Tagged ORF Clone
CAT#: MR227633
- TrueORF®
Mapk1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1
ORF Plasmid: tGFP
"NM_011949" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 2,850.00
Cited in 2 publications. |
CNY 300.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | 9030612K14Rik; AA407128; AU018647; C78273; ERK; Erk2; MAPK2; p41mapk; p42mapk; Prkm1; PRKM2 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR227633 representing NM_011949
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCGGCGGCGGCGGCGGCGGGCCCGGAGATGGTCCGCGGGCAGGTGTTCGACGTAGGGCCGCGCTACA CCAACCTCTCGTACATCGGAGAAGGCGCCTACGGCATGGTTTGCTCTGCTTATGATAATCTCAACAAAGT TCGAGTTGCTATCAAGAAAATCAGTCCTTTTGAGCACCAGACCTACTGTCAAAGAACCCTAAGAGAGATA AAAATCTTACTGCGCTTCAGACATGAGAACATCATTGGCATCAATGACATCATCCGGGCACCAACCATTG AGCAAATGAAAGATGTATATATAGTACAGGACCTCATGGAGACGGACCTTTACAAGCTCTTGAAGACACA GCACCTCAGCAATGACCACATCTGCTATTTTCTTTATCAGATCCTGAGAGGGCTAAAGTATATCCATTCA GCTAACGTTCTGCACCGTGACCTCAAGCCTTCCAACCTCCTGCTGAACACCACTTGTGATCTCAAGATCT GTGACTTTGGCCTTGCCCGTGTTGCAGATCCAGATCATGATCACACAGGGTTCTTGACAGAGTACGTAGC CACACGTTGGTACAGAGCTCCAGAAATTATGTTGAATTCCAAGGGTTATACCAAGTCCATTGATATTTGG TCTGTGGGCTGCATCCTGGCAGAGATGCTATCCAACAGGCCTATCTTCCCAGGAAAGCATTACCTTGACC AGCTGAATCACATCCTGGGTATTCTTGGATCTCCATCACAGGAAGATCTGAATTGTATAATAAATTTAAA AGCTAGAAACTATTTGCTTTCTCTCCCGCACAAAAATAAGGTGCCATGGAACAGGTTGTTCCCAAATGCT GACTCCAAAGCTCTGGATTTACTGGATAAAATGTTGACATTTAACCCTCACAAGAGGATTGAAGTTGAAC AGGCTCTGGCCCACCCATACCTGGAGCAGTATTATGACCCAAGTGATGAGCCCATTGCTGAAGCGCCATT CAAGTTTGACATGGAGTTGGACGACTTACCTAAGGAGAAGCTCAAAGAACTCATTTTTGAAGAGACTGCT AGATTCCAGCCAGGATACAGATCT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR227633 representing NM_011949
Red=Cloning site Green=Tags(s) MAAAAAAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNLNKVRVAIKKISPFEHQTYCQRTLREI KILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHS ANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIW SVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNA DSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA RFQPGYRS myc-FLAG tag |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_011949 |
ORF Size | 1074 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_011949.3, NP_036079.1 |
RefSeq Size | 5099 bp |
RefSeq ORF | 1077 bp |
Locus ID | 26413 |
UniProt ID | P63085 |
MW | 41.7 kDa |
Gene Summary | Serine/threonine kinase which acts as an essential component of the MAP kinase signal transduction pathway. MAPK1/ERK2 and MAPK3/ERK1 are the 2 MAPKs which play an important role in the MAPK/ERK cascade. They participate also in a signaling cascade initiated by activated KIT and KITLG/SCF. Depending on the cellular context, the MAPK/ERK cascade mediates diverse biological functions such as cell growth, adhesion, survival and differentiation through the regulation of transcription, translation, cytoskeletal rearrangements. The MAPK/ERK cascade plays also a role in initiation and regulation of meiosis, mitosis, and postmitotic functions in differentiated cells by phosphorylating a number of transcription factors. About 160 substrates have already been discovered for ERKs. Many of these substrates are localized in the nucleus, and seem to participate in the regulation of transcription upon stimulation. However, other substrates are found in the cytosol as well as in other cellular organelles, and those are responsible for processes such as translation, mitosis and apoptosis. Moreover, the MAPK/ERK cascade is also involved in the regulation of the endosomal dynamics, including lysosome processing and endosome cycling through the perinuclear recycling compartment (PNRC); as well as in the fragmentation of the Golgi apparatus during mitosis. The substrates include transcription factors (such as ATF2, BCL6, ELK1, ERF, FOS, HSF4 or SPZ1), cytoskeletal elements (such as CANX, CTTN, GJA1, MAP2, MAPT, PXN, SORBS3 or STMN1), regulators of apoptosis (such as BAD, BTG2, CASP9, DAPK1, IER3, MCL1 or PPARG), regulators of translation (such as EIF4EBP1) and a variety of other signaling-related molecules (like ARHGEF2, DCC, FRS2 or GRB10). Protein kinases (such as RAF1, RPS6KA1/RSK1, RPS6KA3/RSK2, RPS6KA2/RSK3, RPS6KA6/RSK4, SYK, MKNK1/MNK1, MKNK2/MNK2, RPS6KA5/MSK1, RPS6KA4/MSK2, MAPKAPK3 or MAPKAPK5) and phosphatases (such as DUSP1, DUSP4, DUSP6 or DUSP16) are other substrates which enable the propagation the MAPK/ERK signal to additional cytosolic and nuclear targets, thereby extending the specificity of the cascade. Mediates phosphorylation of TPR in respons to EGF stimulation. May play a role in the spindle assembly checkpoint. Phosphorylates PML and promotes its interaction with PIN1, leading to PML degradation. Phosphorylates CDK2AP2 (By similarity).[UniProtKB/Swiss-Prot Function] |
Citations (2)
The use of this cDNA Clones has been cited in the following citations: |
---|
Transferrin receptor 2 controls bone mass and pathological bone formation via BMP and Wnt signaling
,Rauner, M;Baschant, U;Roetto, A;Pellegrino, RM;Rother, S;Salbach-Hirsch, J;Weidner, H;Hintze, V;Campbell, G;Petzold, A;Lemaitre, R;Henry, I;Bellido, T;Theurl, I;Altamura, S;Colucci, S;Muckenthaler, MU;Schett, G;Komla Ebri, D;Bassett, JHD;Williams, GR;Platzbecker, U;Hofbauer, LC;,
Nat Metab
,PubMed ID 30886999
[MAPK1]
|
Dusp6 is a genetic modifier of growth through enhanced ERK activity
,Vo, AH;Swaggart, KA;Woo, A;Gao, QQ;,
Human Molecular Genetics
,PubMed ID 30289454
[MAPK1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC209720 | Mapk1 (untagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1, (10ug) |
CNY 3,990.00 |
|
MG227633 | Mapk1 (tGFP-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1) transcript variant 1, (10ug) |
CNY 3,140.00 |
|
MR227633L3 | Lenti ORF clone of Mapk1 (Myc-DDK-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1 |
CNY 4,750.00 |
|
MR227633L4 | Lenti ORF clone of Mapk1 (mGFP-tagged) - Mouse mitogen-activated protein kinase 1 (Mapk1), transcript variant 1 |
CNY 4,750.00 |