Cfl2 (NM_007688) Mouse Tagged ORF Clone

CAT#: MR201352

  • TrueORF®

Cfl2 (Myc-DDK-tagged) - Mouse cofilin 2, muscle (Cfl2)

ORF Plasmid: DDK tGFP



  "NM_007688" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2,400.00

CNY 3,705.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

CNY 5,420.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1,280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

CNY 300.00


Rabbit Polyclonal Anti-Cfl2 Antibody
    • 50 ug

CNY 4,628.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR201352 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATCTGGAGTTACAGTGAATGATGAAGTCATCAAAGTTTTTAATGATATGAAAGTAAGAAAATCTT
CTACACAGGAGGAGATCAAAAAAAGAAAGAAAGCAGTTCTCTTCTGTTTGAGCGATGACAAAAGACAAAT
AATTGTAGAGGAAGCCAAGCAGATCTTGGTGGGTGACATTGGTGACACTGTAGAGGACCCCTACACATCT
TTTGTGAAGTTGCTACCTCTGAATGATTGCCGATATGCTTTGTACGATGCCACATACGAAACAAAAGAGT
CTAAGAAAGAAGACCTAGTATTTATATTCTGGGCTCCTGAAAGTGCACCGTTAAAAAGCAAGATGATTTA
TGCTAGCTCTAAAGATGCCATTAAAAAGAAATTTACAGGTATTAAACATGAGTGGCAAGTAAATGGCTTG
GACGATATTAAGGACCGCTCGACGCTGGGAGAGAAACTGGGGGGCAGTGTTGTAGTTTCCCTTGAAGGAA
AGCCACTA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR201352 protein sequence
Red=Cloning site Green=Tags(s)

MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTS
FVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGL
DDIKDRSTLGEKLGGSVVVSLEGKPL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007688
ORF Size 501 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007688.1, NM_007688.2, NP_031714.1
RefSeq Size 2940 bp
RefSeq ORF 501 bp
Locus ID 12632
UniProt ID P45591
MW 18.7 kDa
Gene Summary Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1:1 ratio of cofilin to actin. It is the major component of intranuclear and cytoplasmic actin rods. Required for muscle maintenance. May play a role during the exchange of alpha-actin forms during the early postnatal remodeling of the sarcomere.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...