Lcn2 (NM_008491) Mouse Tagged ORF Clone

CAT#: MG226233

  • TrueORF®

Lcn2 (tGFP-tagged) - Mouse lipocalin 2 (Lcn2), (10ug)

ORF Plasmid: DDK tGFP



  "NM_008491" in other vectors (4)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,200.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00


Goat Polyclonal Antibody against Lcn2 (Internal region)
    • 100 ug

CNY 5,371.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms 24p3; AW212229; NRL; Sip24
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG226233 representing NM_008491
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCCTGAGTGTCATGTGTCTGGGCCTTGCCCTGCTTGGGGTCCTGCAGAGCCAGGCCCAGGACTCAA
CTCAGAACTTGATCCCTGCCCCATCTCTGCTCACTGTCCCCCTGCAGCCAGACTTCCGGAGCGATCAGTT
CCGGGGCAGGTGGTACGTTGTGGGCCTGGCAGGCAATGCGGTCCAGAAAAAAACAGAAGGCAGCTTTACG
ATGTACAGCACCATCTATGAGCTACAAGAGAACAATAGCTACAATGTCACCTCCATCCTGGTCAGGGACC
AGGACCAGGGCTGTCGCTACTGGATCAGAACATTTGTTCCAAGCTCCAGGGCTGGCCAGTTCACTCTGGG
AAATATGCACAGGTATCCTCAGGTACAGAGCTACAATGTGCAAGTGGCCACCACGGACTACAACCAGTTC
GCCATGGTATTTTTCCGAAAGACTTCTGAAAACAAGCAATACTTCAAAATTACCCTGTATGGAAGAACCA
AGGAGCTGTCCCCTGAACTGAAGGAACGTTTCACCCGCTTTGCCAAGTCTCTGGGCCTCAAGGACGACAA
CATCATCTTCTCTGTCCCCACCGACCAATGCATTGACAAC


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG226233 representing NM_008491
Red=Cloning site Green=Tags(s)

MALSVMCLGLALLGVLQSQAQDSTQNLIPAPSLLTVPLQPDFRSDQFRGRWYVVGLAGNAVQKKTEGSFT
MYSTIYELQENNSYNVTSILVRDQDQGCRYWIRTFVPSSRAGQFTLGNMHRYPQVQSYNVQVATTDYNQF
AMVFFRKTSENKQYFKITLYGRTKELSPELKERFTRFAKSLGLKDDNIIFSVPTDQCIDN

TRTRPLE - GFP Tag - V
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_008491
ORF Size 600 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_008491.1, NP_032517.1
RefSeq Size 853 bp
RefSeq ORF 603 bp
Locus ID 16819
UniProt ID P11672
Gene Summary Iron-trafficking protein involved in multiple processes such as apoptosis, innate immunity and renal development (PubMed:12453413). Binds iron through association with 2,5-dihydroxybenzoic acid (2,5-DHBA), a siderophore that shares structural similarities with bacterial enterobactin, and delivers or removes iron from the cell, depending on the context. Iron-bound form (holo-24p3) is internalized following binding to the SLC22A17 (24p3R) receptor, leading to release of iron and subsequent increase of intracellular iron concentration. In contrast, association of the iron-free form (apo-24p3) with the SLC22A17 (24p3R) receptor is followed by association with an intracellular siderophore, iron chelation and iron transfer to the extracellular medium, thereby reducing intracellular iron concentration. Involved in apoptosis due to interleukin-3 (IL3) deprivation: iron-loaded form increases intracellular iron concentration without promoting apoptosis, while iron-free form decreases intracellular iron levels, inducing expression of the proapoptotic protein BCL2L11/BIM, resulting in apoptosis. Involved in innate immunity; limits bacterial proliferation by sequestering iron bound to microbial siderophores, such as enterobactin (PubMed:15531878, PubMed:16446425). Can also bind siderophores from M.tuberculosis (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...