GNB2 Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GNB2 antibody: synthetic peptide directed towards the middle region of human GNB2. Synthetic peptide located within the following region: CCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 37 kDa |
Gene Name | G protein subunit beta 2 |
Database Link | |
Background | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5' UTR. [provided by RefSeq, Jul 2008] |
Synonyms | beta-2 subunit; G(S); G(T) beta subunit 2; G protein; guanine nucleotide-binding protein; guanine nucleotide-binding protein G(I); OTTHUMP00000174601; OTTHUMP00000174602; signal-transducing guanine nucleotide-binding regulatory protein beta |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79% |
Reference Data | |
Protein Pathways | Chemokine signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |