Gasdermin like (GSDMB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GSDML antibody: synthetic peptide directed towards the N terminal of human GSDML. Synthetic peptide located within the following region: HLVGEKRTFFGCRHYTTGLTLMDILDTDGDKWLDELDSGLQGQKAEFQIL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	45 kDa
Gene Name	gasdermin B
Database Link	NP_061000 Entrez Gene 55876 Human UniProt ID Q8TAX9
Background	GSDML belongs to the gasdermin family.GSDML may play a role as secretory or metabolic product involved in secretory pathway. It may also play a role in achieving and maintaining the final differentiation state of epithelial cells.
Synonyms	GSDML; PP4052; PRO2521
Note	Immunogen Sequence Homology: Horse: 100%; Human: 100%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.