CHCHD6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHCHD6 antibody: synthetic peptide directed towards the N terminal of human CHCHD6. Synthetic peptide located within the following region: LPRSGSSGGQQPSGMKEGVKRYEQEHAAIQDKLFQVAKREREAATKHSKA
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	26 kDa
Gene Name	coiled-coil-helix-coiled-coil-helix domain containing 6
Database Link	NP_115719 Entrez Gene 84303 Human UniProt ID Q9BRQ6
Background	The function remains unknown.
Synonyms	CHCM1; Mic25; PPP1R23
Note	Immunogen Sequence Homology: Dog: 100%; Human: 100%; Pig: 90%; Guinea pig: 90%; Rabbit: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.