HELB Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-HELB antibody: synthetic peptide directed towards the N terminal of human HELB. Synthetic peptide located within the following region: FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	120 kDa
Gene Name	helicase (DNA) B
Database Link	NP_387467 Entrez Gene 92797 Human UniProt ID Q8NG08
Background	This gene encodes a DNA-dependent ATPase which catalyzesThe unwinding of DNA necessary for DNA replication, repair, recombination, and transcription.This gene is thought to function specifically duringThe S phase entry ofThe cell cycle. [provided by RefSeq, Mar 2012]
Synonyms	DHB; hDHB
Note	Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Bovine: 86%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.