CYYR1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Cyyr1 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: FVYAEDCRAQCGKDCRAYCCNGSTPHCCSYYAYIGSILSGTAIAGIVFGI
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	18 kDa
Gene Name	cysteine and tyrosine rich 1
Database Link	NP_443186 Entrez Gene 304138 Rat UniProt ID Q96J86
Background	The function of Cyyr1 remains unknown.
Synonyms	C21orf95
Note	Immunogen Sequence Homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 79%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.