C1orf177 (LEXM) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C1orf177 antibody: synthetic peptide directed towards the middle region of human C1orf177. Synthetic peptide located within the following region: YSMQKKKPRELMNFKSFVEELNSHHNKKHGVFSKLPRNPKTPTERIYWAN
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Concentration	lot specific
Purification	Protein A purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	lymphocyte expansion molecule
Database Link	NP_689820 Entrez Gene 163747 Human UniProt ID Q3ZCV2
Background	The specific function of C1orf177 is not yet known.
Synonyms	FLJ40201
Note	Immunogen Sequence Homology: Human: 100%; Rabbit: 93%; Horse: 86%; Bovine: 86%; Dog: 79%; Rat: 79%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.